SCOP 1.71: Domain d1fwib_: 1fwi B:

Lineage for d1fwib_ (1fwi B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1fwib_: 1fwi B: [28327]
   Other proteins in same PDB: d1fwia_, d1fwic1, d1fwic2
   complexed with ni; mutant

Details for d1fwib_

PDB Entry: 1fwi, 2 Å

PDB Description: klebsiella aerogenes urease, h134a variant

SCOP Domain Sequences for d1fwib_:

Sequence; same for both SEQRES and ATOM records:

>d1fwib_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1fwib_:

• d1fwib_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwib_ appears in SCOP 1.69
  
• d1fwib_ appears in SCOP 1.73
  
• d1fwib_ appears in the current release, SCOPe 2.08