SCOP 1.59: Domain d1fwdb_: 1fwd B:

Lineage for d1fwdb_ (1fwd B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.85: beta-clip [51268] (6 superfamilies)

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (25 PDB entries)

8. Domain d1fwdb_: 1fwd B: [28325]
   Other proteins in same PDB: d1fwda_, d1fwdc1, d1fwdc2

Details for d1fwdb_

PDB Entry: 1fwd, 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 9.4

SCOP Domain Sequences for d1fwdb_:

Sequence; same for both SEQRES and ATOM records:

>d1fwdb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1fwdb_:

• d1fwdb_ first appeared (with stable ids) in SCOP 1.55
  
• d1fwdb_ appears in SCOP 1.57
  
• d1fwdb_ appears in SCOP 1.61
  
• d1fwdb_ appears in the current release, SCOPe 2.08