Lineage for d1fwdb_ (1fwd B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18112Fold b.85: beta-clip [51268] (5 superfamilies)
  4. 18162Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 18163Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 18164Protein Urease, beta-subunit [51280] (2 species)
  7. 18170Species Klebsiella aerogenes [TaxId:28451] [51281] (25 PDB entries)
  8. 18176Domain d1fwdb_: 1fwd B: [28325]
    Other proteins in same PDB: d1fwda_, d1fwdc1, d1fwdc2

Details for d1fwdb_

PDB Entry: 1fwd (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 9.4

SCOP Domain Sequences for d1fwdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwdb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOP Domain Coordinates for d1fwdb_:

Click to download the PDB-style file with coordinates for d1fwdb_.
(The format of our PDB-style files is described here.)

Timeline for d1fwdb_: