Lineage for d1fwcb_ (1fwc B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172178Fold b.85: beta-clip [51268] (6 superfamilies)
  4. 172228Superfamily b.85.3: Urease, beta-subunit [51278] (1 family) (S)
  5. 172229Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)
  6. 172230Protein Urease, beta-subunit [51280] (3 species)
  7. 172240Species Klebsiella aerogenes [TaxId:28451] [51281] (25 PDB entries)
  8. 172245Domain d1fwcb_: 1fwc B: [28324]
    Other proteins in same PDB: d1fwca_, d1fwcc1, d1fwcc2

Details for d1fwcb_

PDB Entry: 1fwc (more details), 2 Å

PDB Description: klebsiella aerogenes urease, c319a variant at ph 8.5

SCOP Domain Sequences for d1fwcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fwcb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

SCOP Domain Coordinates for d1fwcb_:

Click to download the PDB-style file with coordinates for d1fwcb_.
(The format of our PDB-style files is described here.)

Timeline for d1fwcb_: