SCOP 1.69: Domain d1ejtb_: 1ejt B:

Lineage for d1ejtb_ (1ejt B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.3: Urease, beta-subunit [51278] (1 family)

5. Family b.85.3.1: Urease, beta-subunit [51279] (1 protein)

6. Protein Urease, beta-subunit [51280] (3 species)

7. Species Klebsiella aerogenes [TaxId:28451] [51281] (27 PDB entries)

8. Domain d1ejtb_: 1ejt B: [28321]
   Other proteins in same PDB: d1ejta_, d1ejtc1, d1ejtc2

Details for d1ejtb_

PDB Entry: 1ejt, 2 Å

PDB Description: crystal structure of the h219q variant of klebsiella aerogenes urease

SCOP Domain Sequences for d1ejtb_:

Sequence; same for both SEQRES and ATOM records:

>d1ejtb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes}
mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl

Timeline for d1ejtb_:

• d1ejtb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ejtb_ appears in SCOP 1.67
  
• d1ejtb_ appears in SCOP 1.71
  
• d1ejtb_ appears in the current release, SCOPe 2.08