Lineage for d3nlaa_ (3nla A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811033Superfamily b.85.1: AFP III-like domain [51269] (1 family) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 811034Family b.85.1.1: AFP III-like domain [51270] (3 proteins)
    Pfam PF01354
  6. 811044Protein Type III antifreeze protein, AFP III [51271] (3 species)
  7. 811045Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries)
    duplication: intramolecular dimer
  8. 811050Domain d3nlaa_: 3nla A: [28316]
    N-Terminal domain with a linker portion

Details for d3nlaa_

PDB Entry: 3nla (more details)

PDB Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, 40 structures
PDB Compounds: (A:) antifreeze protein rd3 type III

SCOP Domain Sequences for d3nlaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nlaa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglk

SCOP Domain Coordinates for d3nlaa_:

Click to download the PDB-style file with coordinates for d3nlaa_.
(The format of our PDB-style files is described here.)

Timeline for d3nlaa_: