Lineage for d3nla__ (3nla -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) 
Superfamily b.85.1: Type III antifreeze protein [51269] (1 family) 
Family b.85.1.1: Type III antifreeze protein [51270] (1 protein) Protein Type III antifreeze protein [51271] (2 species) 
Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni) [51273] (4 PDB entries) 
Domain d3nla__: 3nla - [28316]
Details for d3nla__
PDB Entry: 3nla (more details)
PDB Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, 40 structures
SCOP Domain Sequences for d3nla__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nla__ b.85.1.1 (-) Type III antifreeze protein {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni)}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglk
SCOP Domain Coordinates for d3nla__:
Click to download the PDB-style file with coordinates for d3nla__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3nla__:
- d3nla__ appears in SCOP 1.57
- d3nla__ appears in the current release, SCOPe 2.08, called d3nlaa_
View in 3D