Lineage for d1c89a2 (1c89 A:69-134)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964423Superfamily b.85.1: AFP III-like domain [51269] (1 family) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 964424Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 964434Protein Type III antifreeze protein, AFP III [51271] (3 species)
  7. 964435Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries)
    duplication: intramolecular dimer
  8. 964440Domain d1c89a2: 1c89 A:69-134 [28315]

Details for d1c89a2

PDB Entry: 1c89 (more details)

PDB Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
PDB Compounds: (A:) antifreeze protein type III

SCOPe Domain Sequences for d1c89a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c89a2 b.85.1.1 (A:69-134) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
spglksvvanqlipintaltlvmmkaeevspkgipseeisklvgmqvnravyldqtlmpd
mvknye

SCOPe Domain Coordinates for d1c89a2:

Click to download the PDB-style file with coordinates for d1c89a2.
(The format of our PDB-style files is described here.)

Timeline for d1c89a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c89a1