Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.1: AFP III-like domain [51269] (1 family) duplication: consists of two structural repeats related by pseudo dyad |
Family b.85.1.1: AFP III-like domain [51270] (3 proteins) Pfam PF01354 |
Protein Type III antifreeze protein, AFP III [51271] (3 species) |
Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries) duplication: intramolecular dimer |
Domain d1c89a1: 1c89 A:1-68 [28314] |
PDB Entry: 1c89 (more details)
SCOP Domain Sequences for d1c89a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c89a1 b.85.1.1 (A:1-68) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]} nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv knyedgtt
Timeline for d1c89a1: