SCOP 1.57: Domain d1c89a1: 1c89 A:1-68

Lineage for d1c89a1 (1c89 A:1-68)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.85: beta-clip [51268] (6 superfamilies)

4. Superfamily b.85.1: Type III antifreeze protein [51269] (1 family)

5. Family b.85.1.1: Type III antifreeze protein [51270] (1 protein)

6. Protein Type III antifreeze protein [51271] (2 species)

7. Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni) [51273] (4 PDB entries)

8. Domain d1c89a1: 1c89 A:1-68 [28314]

Details for d1c89a1

PDB Entry: 1c89

PDB Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures

SCOP Domain Sequences for d1c89a1:

Sequence; same for both SEQRES and ATOM records:

>d1c89a1 b.85.1.1 (A:1-68) Type III antifreeze protein {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni)}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgtt

Timeline for d1c89a1:

• d1c89a1 first appeared (with stable ids) in SCOP 1.55
  
• d1c89a1 appears in SCOP 1.59
  
• d1c89a1 appears in the current release, SCOPe 2.08