Lineage for d1c8aa1 (1c8a A:1-68)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2083143Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2083144Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2083145Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 2083155Protein Type III antifreeze protein, AFP III [51271] (3 species)
  7. 2083156Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries)
    duplication: intramolecular dimer
  8. 2083158Domain d1c8aa1: 1c8a A:1-68 [28312]

Details for d1c8aa1

PDB Entry: 1c8a (more details)

PDB Description: nmr structure of intramolecular dimer antifreeze protein rd3, 40 sa structures
PDB Compounds: (A:) protein (antifreeze protein type III)

SCOPe Domain Sequences for d1c8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8aa1 b.85.1.1 (A:1-68) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgtt

SCOPe Domain Coordinates for d1c8aa1:

Click to download the PDB-style file with coordinates for d1c8aa1.
(The format of our PDB-style files is described here.)

Timeline for d1c8aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c8aa2