SCOPe 2.02: Domain d3rdna_: 3rdn A:

Lineage for d3rdna_ (3rdn A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.1: AFP III-like domain [51269] (1 family)
   duplication: consists of two structural repeats related by pseudo dyad

5. Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
   Pfam PF01354

6. Protein Type III antifreeze protein, AFP III [51271] (3 species)

7. Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries)
   duplication: intramolecular dimer

8. Domain d3rdna_: 3rdn A: [28311]
   N-Terminal domain with a linker portion

Details for d3rdna_

PDB Entry: 3rdn

PDB Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure

PDB Compounds: (A:) antifreeze protein rd3 type III

SCOPe Domain Sequences for d3rdna_:

Sequence; same for both SEQRES and ATOM records:

>d3rdna_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglk

Timeline for d3rdna_:

• d3rdna_ first appeared (with stable ids) in SCOP 1.55, called d3rdn__
  
• d3rdna_ appears in SCOPe 2.01
  
• d3rdna_ appears in SCOPe 2.03
  
• d3rdna_ appears in the current release, SCOPe 2.08