Lineage for d3rdna_ (3rdn A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964423Superfamily b.85.1: AFP III-like domain [51269] (1 family) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 964424Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 964434Protein Type III antifreeze protein, AFP III [51271] (3 species)
  7. 964435Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries)
    duplication: intramolecular dimer
  8. 964436Domain d3rdna_: 3rdn A: [28311]
    N-Terminal domain with a linker portion

Details for d3rdna_

PDB Entry: 3rdn (more details)

PDB Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
PDB Compounds: (A:) antifreeze protein rd3 type III

SCOPe Domain Sequences for d3rdna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rdna_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglk

SCOPe Domain Coordinates for d3rdna_:

Click to download the PDB-style file with coordinates for d3rdna_.
(The format of our PDB-style files is described here.)

Timeline for d3rdna_: