![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.1: AFP III-like domain [51269] (1 family) ![]() duplication: consists of two structural repeats related by pseudo dyad |
![]() | Family b.85.1.1: AFP III-like domain [51270] (3 proteins) Pfam PF01354 |
![]() | Protein Type III antifreeze protein, AFP III [51271] (3 species) |
![]() | Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId:36221] [51273] (4 PDB entries) duplication: intramolecular dimer |
![]() | Domain d3rdna_: 3rdn A: [28311] N-Terminal domain with a linker portion |
PDB Entry: 3rdn (more details)
SCOP Domain Sequences for d3rdna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdna_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni), RD3 isoform [TaxId: 36221]} nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv knyedgttspglk
Timeline for d3rdna_: