Lineage for d3rdn__ (3rdn -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.85: beta-clip [51268] (6 superfamilies) 
Superfamily b.85.1: Type III antifreeze protein [51269] (1 family) 
Family b.85.1.1: Type III antifreeze protein [51270] (1 protein) Protein Type III antifreeze protein [51271] (2 species) 
Species Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni) [51273] (4 PDB entries) 
Domain d3rdn__: 3rdn - [28311]
Details for d3rdn__
PDB Entry: 3rdn (more details)
PDB Description: nmr structure of the n-terminal domain with a linker portion of antarctic eel pout antifreeze protein rd3, minimized average structure
SCOP Domain Sequences for d3rdn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rdn__ b.85.1.1 (-) Type III antifreeze protein {Antarctic eel pout (Austrolycichthys brachycephalus) and (Lycodichthys dearborni)}
nkasvvanqlipintaltlimmkaevvtpmgipaeeipnlvgmqvnravplgttlmpdmv
knyedgttspglk
SCOP Domain Coordinates for d3rdn__:
Click to download the PDB-style file with coordinates for d3rdn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3rdn__:
- d3rdn__ first appeared (with stable ids) in SCOP 1.55
- d3rdn__ appears in SCOP 1.57
- d3rdn__ appears in SCOP 1.61
- d3rdn__ appears in the current release, SCOPe 2.08, called d3rdna_
View in 3D