Class b: All beta proteins [48724] (176 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.1: AFP III-like domain [51269] (2 families) duplication: consists of two structural repeats related by pseudo dyad |
Family b.85.1.1: AFP III-like domain [51270] (4 proteins) Pfam PF01354 |
Protein Type III antifreeze protein, AFP III [51271] (3 species) |
Species Ocean pout (Macrozoarces americanus), different isoforms [TaxId:8199] [51272] (31 PDB entries) |
Domain d1opsa_: 1ops A: [28302] |
PDB Entry: 1ops (more details), 2 Å
SCOPe Domain Sequences for d1opsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1opsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]} sqsvvatqlipmntaltpammegkvtnpigipfaemsqlvgkqvntpvakgqtlmpnmvk tyaa
Timeline for d1opsa_: