Lineage for d1opsa_ (1ops A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1809317Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1809318Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 1809319Family b.85.1.1: AFP III-like domain [51270] (4 proteins)
    Pfam PF01354
  6. 1809329Protein Type III antifreeze protein, AFP III [51271] (3 species)
  7. 1809339Species Ocean pout (Macrozoarces americanus), different isoforms [TaxId:8199] [51272] (31 PDB entries)
  8. 1809362Domain d1opsa_: 1ops A: [28302]

Details for d1opsa_

PDB Entry: 1ops (more details), 2 Å

PDB Description: ice-binding surface on a type iii antifreeze protein from ocean pout
PDB Compounds: (A:) type III antifreeze protein

SCOPe Domain Sequences for d1opsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1opsa_ b.85.1.1 (A:) Type III antifreeze protein, AFP III {Ocean pout (Macrozoarces americanus), different isoforms [TaxId: 8199]}
sqsvvatqlipmntaltpammegkvtnpigipfaemsqlvgkqvntpvakgqtlmpnmvk
tyaa

SCOPe Domain Coordinates for d1opsa_:

Click to download the PDB-style file with coordinates for d1opsa_.
(The format of our PDB-style files is described here.)

Timeline for d1opsa_: