Lineage for d1ops__ (1ops -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.85: beta-clip [51268] (5 superfamilies) 
Superfamily b.85.1: Type III antifreeze protein [51269] (1 family) 
Family b.85.1.1: Type III antifreeze protein [51270] (1 protein) Protein Type III antifreeze protein [51271] (2 species) Species Ocean pout (Macrozoarces americanus), different isoforms [TaxId:8199] [51272] (31 PDB entries) 
Domain d1ops__: 1ops - [28302]
Details for d1ops__
PDB Entry: 1ops (more details), 2 Å
PDB Description: ice-binding surface on a type iii antifreeze protein from ocean pout
SCOP Domain Sequences for d1ops__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ops__ b.85.1.1 (-) Type III antifreeze protein {Ocean pout (Macrozoarces americanus), different isoforms}
sqsvvatqlipmntaltpammegkvtnpigipfaemsqlvgkqvntpvakgqtlmpnmvk
tyaa
SCOP Domain Coordinates for d1ops__:
Click to download the PDB-style file with coordinates for d1ops__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ops__:
- d1ops__ appears in SCOP 1.57
- d1ops__ appears in the current release, SCOPe 2.08, called d1opsa_
View in 3D