Lineage for d1glef_ (1gle F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072281Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 2072282Family b.84.3.1: Glucose permease-like [51262] (3 protein domains)
  6. 2072289Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 2072290Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)
  8. 2072299Domain d1glef_: 1gle F: [28278]
    Other proteins in same PDB: d1gleg1, d1gleg2
    complexed with adp, g3h, zn

Details for d1glef_

PDB Entry: 1gle (more details), 2.94 Å

PDB Description: cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation
PDB Compounds: (F:) GLUCOSE-SPECIFIC PROTEIN IIIGlc

SCOPe Domain Sequences for d1glef_:

Sequence, based on SEQRES records: (download)

>d1glef_ b.84.3.1 (F:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
glfdklkslvsddkkdtgtieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmv
apvdgtigkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtvi
efdlplleekakstltpvvisnmdeikeliklsgsvtvgetpvirikk

Sequence, based on observed residues (ATOM records): (download)

>d1glef_ b.84.3.1 (F:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
glfdklkslvstieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgti
gkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlpll
eekakstltpvvisnmdeikeliklsgsvtvgetpvirikk

SCOPe Domain Coordinates for d1glef_:

Click to download the PDB-style file with coordinates for d1glef_.
(The format of our PDB-style files is described here.)

Timeline for d1glef_: