Lineage for d1glaf_ (1gla F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072005Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2072281Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 2072282Family b.84.3.1: Glucose permease-like [51262] (3 protein domains)
  6. 2072289Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 2072290Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)
  8. 2072295Domain d1glaf_: 1gla F: [28274]
    Other proteins in same PDB: d1glag1, d1glag2
    complexed with gol

Details for d1glaf_

PDB Entry: 1gla (more details), 2.6 Å

PDB Description: structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
PDB Compounds: (F:) GLUCOSE-SPECIFIC PROTEIN IIIGlc

SCOPe Domain Sequences for d1glaf_:

Sequence, based on SEQRES records: (download)

>d1glaf_ b.84.3.1 (F:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
glfdklkslvsddkkdtgtieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmv
apvdgtigkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtvi
efdlplleekakstltpvvisnmdeikeliklsgsvtvgetpvirikk

Sequence, based on observed residues (ATOM records): (download)

>d1glaf_ b.84.3.1 (F:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
glfdklkslvstieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgti
gkifetnhafsiesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlpll
eekakstltpvvisnmdeikeliklsgsvtvgetpvirikk

SCOPe Domain Coordinates for d1glaf_:

Click to download the PDB-style file with coordinates for d1glaf_.
(The format of our PDB-style files is described here.)

Timeline for d1glaf_: