SCOPe 2.06: Domain d1f3za_: 1f3z A:

Lineage for d1f3za_ (1f3z A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (3 proteins)

6. Protein Glucose-specific factor III (glsIII) [51266] (1 species)
   synonym: enzyme IIa-glc

7. Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)

8. Domain d1f3za_: 1f3z A: [28273]
   complexed with zn

Details for d1f3za_

PDB Entry: 1f3z, 1.98 Å

PDB Description: iiaglc-zn complex

PDB Compounds: (A:) glucose-specific phosphocarrier

SCOPe Domain Sequences for d1f3za_:

Sequence; same for both SEQRES and ATOM records:

>d1f3za_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

Timeline for d1f3za_:

• d1f3za_ first appeared (with stable ids) in SCOP 1.55, called d1f3z__
  
• d1f3za_ appears in SCOPe 2.05
  
• d1f3za_ appears in SCOPe 2.07
  
• d1f3za_ appears in the current release, SCOPe 2.08