Lineage for d1f3za_ (1f3z A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332206Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) (S)
    half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets
  5. 1332207Family b.84.3.1: Glucose permease-like [51262] (3 proteins)
  6. 1332214Protein Glucose-specific factor III (glsIII) [51266] (1 species)
    synonym: enzyme IIa-glc
  7. 1332215Species Escherichia coli [TaxId:562] [51267] (10 PDB entries)
  8. 1332219Domain d1f3za_: 1f3z A: [28273]
    complexed with zn

Details for d1f3za_

PDB Entry: 1f3z (more details), 1.98 Å

PDB Description: iiaglc-zn complex
PDB Compounds: (A:) glucose-specific phosphocarrier

SCOPe Domain Sequences for d1f3za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f3za_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

SCOPe Domain Coordinates for d1f3za_:

Click to download the PDB-style file with coordinates for d1f3za_.
(The format of our PDB-style files is described here.)

Timeline for d1f3za_: