SCOPe 2.05: Domain d2f3gb_: 2f3g B:

Lineage for d2f3gb_ (2f3g B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families)
   half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets

5. Family b.84.3.1: Glucose permease-like [51262] (3 proteins)

6. Protein Glucose-specific factor III (glsIII) [51266] (1 species)
   synonym: enzyme IIa-glc

7. Species Escherichia coli [TaxId:562] [51267] (11 PDB entries)

8. Domain d2f3gb_: 2f3g B: [28271]

Details for d2f3gb_

PDB Entry: 2f3g, 2.13 Å

PDB Description: iiaglc crystal form iii

PDB Compounds: (B:) glucose-specific phosphocarrier

SCOPe Domain Sequences for d2f3gb_:

Sequence; same for both SEQRES and ATOM records:

>d2f3gb_ b.84.3.1 (B:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk

Timeline for d2f3gb_:

• d2f3gb_ first appeared (with stable ids) in SCOP 1.55
  
• d2f3gb_ appears in SCOPe 2.04
  
• d2f3gb_ appears in SCOPe 2.06
  
• d2f3gb_ appears in the current release, SCOPe 2.08