Lineage for d2f3gb_ (2f3g B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.3: Duplicated hybrid motif [51261] (1 family) 
Family b.84.3.1: Glucose permease-like [51262] (2 proteins) 
Protein Glucose-specific factor III (glsIII) [51266] (1 species) Species Escherichia coli [TaxId:562] [51267] (9 PDB entries) 
Domain d2f3gb_: 2f3g B: [28271]
Details for d2f3gb_
PDB Entry: 2f3g (more details), 2.13 Å
PDB Description: iiaglc crystal form iii
SCOP Domain Sequences for d2f3gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3gb_ b.84.3.1 (B:) Glucose-specific factor III (glsIII) {Escherichia coli}
tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs
iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv
visnmdeikeliklsgsvtvgetpvirikk
SCOP Domain Coordinates for d2f3gb_:
Click to download the PDB-style file with coordinates for d2f3gb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f3gb_:
- d2f3gb_ appears in SCOP 1.57
- d2f3gb_ appears in the current release, SCOPe 2.08
View in 3D
