![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.3: Duplicated hybrid motif [51261] (2 families) ![]() half-barrel sheet of 8 strands sandwiched with two 3-stranded sheets |
![]() | Family b.84.3.1: Glucose permease-like [51262] (3 proteins) |
![]() | Protein Glucose-specific factor III (glsIII) [51266] (1 species) synonym: enzyme IIa-glc |
![]() | Species Escherichia coli [TaxId:562] [51267] (10 PDB entries) |
![]() | Domain d2f3ga_: 2f3g A: [28270] |
PDB Entry: 2f3g (more details), 2.13 Å
SCOPe Domain Sequences for d2f3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f3ga_ b.84.3.1 (A:) Glucose-specific factor III (glsIII) {Escherichia coli [TaxId: 562]} tieiiaplsgeivniedvpdvvfaekivgdgiaikptgnkmvapvdgtigkifetnhafs iesdsgvelfvhfgidtvelkgegfkriaeegqrvkvgdtviefdlplleekakstltpv visnmdeikeliklsgsvtvgetpvirikk
Timeline for d2f3ga_: