SCOPe 2.06: Domain d1e2zb2: 1e2z B:169-232

Lineage for d1e2zb2 (1e2z B:169-232)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)

8. Domain d1e2zb2: 1e2z B:169-232 [28264]
   Other proteins in same PDB: d1e2za1, d1e2zb1, d1e2zc1
   complexed with hec; mutant

Details for d1e2zb2

PDB Entry: 1e2z, 2.5 Å

PDB Description: q158l mutant of cytochrome f from chlamydomonas reinhardtii

PDB Compounds: (B:) cytochrome f

SCOPe Domain Sequences for d1e2zb2:

Sequence; same for both SEQRES and ATOM records:

>d1e2zb2 b.84.2.2 (B:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

Timeline for d1e2zb2:

• d1e2zb2 first appeared (with stable ids) in SCOP 1.55
  
• d1e2zb2 appears in SCOPe 2.05
  
• d1e2zb2 appears in SCOPe 2.07
  
• d1e2zb2 appears in the current release, SCOPe 2.08