Lineage for d1ewhb2 (1ewh B:169-232)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63833Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 63870Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 63896Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 63897Protein Cytochrome f, small domain [51257] (3 species)
  7. 63898Species Chlamydomonas reinhardtii [TaxId:3055] [51259] (5 PDB entries)
  8. 63908Domain d1ewhb2: 1ewh B:169-232 [28261]
    Other proteins in same PDB: d1ewha1, d1ewhb1, d1ewhc1

Details for d1ewhb2

PDB Entry: 1ewh (more details), 2.35 Å

PDB Description: structure of cytochrome f from chlamydomonas reinhardtii

SCOP Domain Sequences for d1ewhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewhb2 b.84.2.2 (B:169-232) Cytochrome f, small domain {Chlamydomonas reinhardtii}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOP Domain Coordinates for d1ewhb2:

Click to download the PDB-style file with coordinates for d1ewhb2.
(The format of our PDB-style files is described here.)

Timeline for d1ewhb2: