Lineage for d1cfma2 (1cfm A:169-232)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2426980Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)
  6. 2426981Protein Cytochrome f, small domain [51257] (5 species)
  7. 2426982Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [51259] (6 PDB entries)
  8. 2426988Domain d1cfma2: 1cfm A:169-232 [28257]
    Other proteins in same PDB: d1cfma1, d1cfmb1, d1cfmc1
    complexed with hem

Details for d1cfma2

PDB Entry: 1cfm (more details), 2 Å

PDB Description: cytochrome f from chlamydomonas reinhardtii
PDB Compounds: (A:) cytochrome f

SCOPe Domain Sequences for d1cfma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cfma2 b.84.2.2 (A:169-232) Cytochrome f, small domain {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
tiynasaagkivaitalsekkggfevsiekangevvvdkipagpdlivkegqtvqadqpl
tnnp

SCOPe Domain Coordinates for d1cfma2:

Click to download the PDB-style file with coordinates for d1cfma2.
(The format of our PDB-style files is described here.)

Timeline for d1cfma2: