SCOPe 2.08: Domain d1ctma2: 1ctm A:168-230

Lineage for d1ctma2 (1ctm A:168-230)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Turnip (Brassica rapa) [TaxId:3711] [51258] (2 PDB entries)

8. Domain d1ctma2: 1ctm A:168-230 [28251]
   Other proteins in same PDB: d1ctma1
   complexed with hec

Details for d1ctma2

PDB Entry: 1ctm, 2.3 Å

PDB Description: crystal structure of chloroplast cytochrome f reveals a novel cytochrome fold and unexpected heme ligation

PDB Compounds: (A:) cytochrome f

SCOPe Domain Sequences for d1ctma2:

Sequence; same for both SEQRES and ATOM records:

>d1ctma2 b.84.2.2 (A:168-230) Cytochrome f, small domain {Turnip (Brassica rapa) [TaxId: 3711]}
ntvynataggiiskilrkekggyeitivdasnerqvidiiprglellvsegesikldqpl
tsn

Timeline for d1ctma2:

• d1ctma2 first appeared (with stable ids) in SCOP 1.55, called d1ctm_2
  
• d1ctma2 appears in SCOPe 2.07