SCOPe 2.05: Domain d1hcza2: 1hcz A:168-230

Lineage for d1hcza2 (1hcz A:168-230)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.2: Cytochrome f, small domain [51256] (1 protein)

6. Protein Cytochrome f, small domain [51257] (5 species)

7. Species Turnip (Brassica rapa) [TaxId:3711] [51258] (2 PDB entries)

8. Domain d1hcza2: 1hcz A:168-230 [28250]
   Other proteins in same PDB: d1hcza1
   complexed with hem

Details for d1hcza2

PDB Entry: 1hcz, 1.96 Å

PDB Description: lumen-side domain of reduced cytochrome f at-35 degrees celsius

PDB Compounds: (A:) cytochrome f

SCOPe Domain Sequences for d1hcza2:

Sequence; same for both SEQRES and ATOM records:

>d1hcza2 b.84.2.2 (A:168-230) Cytochrome f, small domain {Turnip (Brassica rapa) [TaxId: 3711]}
ntvynataggiiskilrkekggyeitivdasnerqvidiiprglellvsegesikldqpl
tsn

Timeline for d1hcza2:

• d1hcza2 first appeared (with stable ids) in SCOP 1.55, called d1hcz_2
  
• d1hcza2 appears in SCOPe 2.04
  
• d1hcza2 appears in SCOPe 2.06
  
• d1hcza2 appears in the current release, SCOPe 2.08