SCOPe 2.07: Domain d1ez1a1: 1ez1 A:319-392

Lineage for d1ez1a1 (1ez1 A:319-392)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)

7. Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)

8. Domain d1ez1a1: 1ez1 A:319-392 [28248]
   Other proteins in same PDB: d1ez1a2, d1ez1a3, d1ez1b2, d1ez1b3
   complexed with act, anp, gar, mg, mpo, na

Details for d1ez1a1

PDB Entry: 1ez1, 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase 2

SCOPe Domain Sequences for d1ez1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ez1a1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli [TaxId: 562]}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

Timeline for d1ez1a1:

• d1ez1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ez1a1 appears in SCOPe 2.06
  
• d1ez1a1 appears in the current release, SCOPe 2.08