Lineage for d1ez1a1 (1ez1 A:319-392)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 63833Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 63870Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 63871Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 63883Protein Glycinamide ribonucleotide transformylase PurT [51254] (1 species)
  7. 63884Species Escherichia coli [TaxId:562] [51255] (2 PDB entries)
  8. 63887Domain d1ez1a1: 1ez1 A:319-392 [28248]
    Other proteins in same PDB: d1ez1a2, d1ez1a3, d1ez1b2, d1ez1b3

Details for d1ez1a1

PDB Entry: 1ez1 (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg, amppnp, and gar

SCOP Domain Sequences for d1ez1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ez1a1 b.84.2.1 (A:319-392) Glycinamide ribonucleotide transformylase PurT {Escherichia coli}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOP Domain Coordinates for d1ez1a1:

Click to download the PDB-style file with coordinates for d1ez1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ez1a1: