![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) ![]() |
![]() | Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
![]() | Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51255] (7 PDB entries) |
![]() | Domain d1eyzb1: 1eyz B:319-392 [28247] Other proteins in same PDB: d1eyza2, d1eyza3, d1eyzb2, d1eyzb3 complexed with anp, cl, mg, mpo, na |
PDB Entry: 1eyz (more details), 1.75 Å
SCOP Domain Sequences for d1eyzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eyzb1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli} gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai erakhaagqvkvqg
Timeline for d1eyzb1: