Lineage for d1eyzb1 (1eyz B:319-392)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567972Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 568020Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 568021Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 568044Protein Glycinamide ribonucleotide transformylase PurT, C-domain [51254] (1 species)
  7. 568045Species Escherichia coli [TaxId:562] [51255] (7 PDB entries)
  8. 568055Domain d1eyzb1: 1eyz B:319-392 [28247]
    Other proteins in same PDB: d1eyza2, d1eyza3, d1eyzb2, d1eyzb3
    complexed with anp, cl, mg, mpo, na

Details for d1eyzb1

PDB Entry: 1eyz (more details), 1.75 Å

PDB Description: structure of escherichia coli purt-encoded glycinamide ribonucleotide transformylase complexed with mg and amppnp

SCOP Domain Sequences for d1eyzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eyzb1 b.84.2.1 (B:319-392) Glycinamide ribonucleotide transformylase PurT, C-domain {Escherichia coli}
gpaasavilpqltsqnvtfdnvqnavgadlqirlfgkpeidgsrrlgvalataesvvdai
erakhaagqvkvqg

SCOP Domain Coordinates for d1eyzb1:

Click to download the PDB-style file with coordinates for d1eyzb1.
(The format of our PDB-style files is described here.)

Timeline for d1eyzb1: