SCOPe 2.08: Domain d1b6sc1: 1b6s C:277-355

Lineage for d1b6sc1 (1b6s C:277-355)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)

7. Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)

8. Domain d1b6sc1: 1b6s C:277-355 [28244]
   Other proteins in same PDB: d1b6sa2, d1b6sa3, d1b6sb2, d1b6sb3, d1b6sc2, d1b6sc3, d1b6sd2, d1b6sd3
   complexed with adp, mg

Details for d1b6sc1

PDB Entry: 1b6s, 2.5 Å

PDB Description: structure of n5-carboxyaminoimidazole ribonucleotide synthetase

PDB Compounds: (C:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOPe Domain Sequences for d1b6sc1:

Sequence; same for both SEQRES and ATOM records:

>d1b6sc1 b.84.2.1 (C:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

Timeline for d1b6sc1:

• d1b6sc1 first appeared (with stable ids) in SCOP 1.55
  
• d1b6sc1 appears in SCOPe 2.07