Lineage for d1b6sb1 (1b6s B:277-355)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810849Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 810850Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 810899Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)
  7. 810900Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)
  8. 810907Domain d1b6sb1: 1b6s B:277-355 [28243]
    Other proteins in same PDB: d1b6sa2, d1b6sa3, d1b6sb2, d1b6sb3, d1b6sc2, d1b6sc3, d1b6sd2, d1b6sd3

Details for d1b6sb1

PDB Entry: 1b6s (more details), 2.5 Å

PDB Description: structure of n5-carboxyaminoimidazole ribonucleotide synthetase
PDB Compounds: (B:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOP Domain Sequences for d1b6sb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6sb1 b.84.2.1 (B:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOP Domain Coordinates for d1b6sb1:

Click to download the PDB-style file with coordinates for d1b6sb1.
(The format of our PDB-style files is described here.)

Timeline for d1b6sb1: