![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
![]() | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
![]() | Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
![]() | Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [51253] (4 PDB entries) |
![]() | Domain d1b6sb1: 1b6s B:277-355 [28243] Other proteins in same PDB: d1b6sa2, d1b6sa3, d1b6sb2, d1b6sb3, d1b6sc2, d1b6sc3, d1b6sd2, d1b6sd3 complexed with adp, mg |
PDB Entry: 1b6s (more details), 2.5 Å
SCOPe Domain Sequences for d1b6sb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b6sb1 b.84.2.1 (B:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]} nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali pllppeyasgviwaqskfg
Timeline for d1b6sb1: