Lineage for d1b6sa1 (1b6s A:277-355)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082834Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2082835Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2082919Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)
  7. 2082920Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)
  8. 2082926Domain d1b6sa1: 1b6s A:277-355 [28242]
    Other proteins in same PDB: d1b6sa2, d1b6sa3, d1b6sb2, d1b6sb3, d1b6sc2, d1b6sc3, d1b6sd2, d1b6sd3
    complexed with adp, mg

Details for d1b6sa1

PDB Entry: 1b6s (more details), 2.5 Å

PDB Description: structure of n5-carboxyaminoimidazole ribonucleotide synthetase
PDB Compounds: (A:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOPe Domain Sequences for d1b6sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6sa1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOPe Domain Coordinates for d1b6sa1:

Click to download the PDB-style file with coordinates for d1b6sa1.
(The format of our PDB-style files is described here.)

Timeline for d1b6sa1: