Lineage for d1b6ra1 (1b6r A:277-355)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 18007Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 18044Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 18045Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 18063Protein N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK [51252] (1 species)
  7. 18064Species Escherichia coli [TaxId:562] [51253] (2 PDB entries)
  8. 18065Domain d1b6ra1: 1b6r A:277-355 [28241]
    Other proteins in same PDB: d1b6ra2, d1b6ra3

Details for d1b6ra1

PDB Entry: 1b6r (more details), 2.1 Å

PDB Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli

SCOP Domain Sequences for d1b6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ra1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase, AIRC, PurK {Escherichia coli}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOP Domain Coordinates for d1b6ra1:

Click to download the PDB-style file with coordinates for d1b6ra1.
(The format of our PDB-style files is described here.)

Timeline for d1b6ra1: