Lineage for d1b6ra1 (1b6r A:277-355)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817541Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 2817625Protein N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain [51252] (1 species)
  7. 2817626Species Escherichia coli [TaxId:562] [51253] (4 PDB entries)
  8. 2817631Domain d1b6ra1: 1b6r A:277-355 [28241]
    Other proteins in same PDB: d1b6ra2, d1b6ra3
    complexed with so4

Details for d1b6ra1

PDB Entry: 1b6r (more details), 2.1 Å

PDB Description: n5-carboxyaminoimidazole ribonucleotide synthetase from e. coli
PDB Compounds: (A:) protein (n5-carboxyaminoimidazole ribonucleotide synthetase)

SCOPe Domain Sequences for d1b6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ra1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}
nnpsvminligsdvnydwlklplvhlhwydkevrpgrkvghlnltdsdtsrltatleali
pllppeyasgviwaqskfg

SCOPe Domain Coordinates for d1b6ra1:

Click to download the PDB-style file with coordinates for d1b6ra1.
(The format of our PDB-style files is described here.)

Timeline for d1b6ra1: