Lineage for d1gsoa1 (1gso A:328-426)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 678222Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 678273Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 678274Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 678297Protein Glycinamide ribonucleotide synthetase (GAR-syn), C-domain [51250] (2 species)
  7. 678298Species Escherichia coli [TaxId:562] [51251] (1 PDB entry)
  8. 678299Domain d1gsoa1: 1gso A:328-426 [28240]
    Other proteins in same PDB: d1gsoa2, d1gsoa3
    mutant

Details for d1gsoa1

PDB Entry: 1gso (more details), 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.
PDB Compounds: (A:) protein (glycinamide ribonucleotide synthetase)

SCOP Domain Sequences for d1gsoa1:

Sequence, based on SEQRES records: (download)

>d1gsoa1 b.84.2.1 (A:328-426) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Escherichia coli [TaxId: 562]}
eraslgvvmaaggypgdyrtgdvihglpleevaggkvfhagtkladdeqvvtnggrvlcv
talghtvaeaqkrayalmtdihwddcfcrkdigwraier

Sequence, based on observed residues (ATOM records): (download)

>d1gsoa1 b.84.2.1 (A:328-426) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Escherichia coli [TaxId: 562]}
eraslgvvmaaggypgdyrtgdvihglpleevaggkvfhagtklaqvvtnggrvlcvtal
ghtvaeaqkrayalmtdihwddcfcrkdigwraier

SCOP Domain Coordinates for d1gsoa1:

Click to download the PDB-style file with coordinates for d1gsoa1.
(The format of our PDB-style files is described here.)

Timeline for d1gsoa1: