Lineage for d1gsoa1 (1gso A:328-426)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 303581Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 303625Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 303626Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 303635Protein Glycinamide ribonucleotide synthetase (GAR-syn), C-domain [51250] (1 species)
  7. 303636Species Escherichia coli [TaxId:562] [51251] (1 PDB entry)
  8. 303637Domain d1gsoa1: 1gso A:328-426 [28240]
    Other proteins in same PDB: d1gsoa2, d1gsoa3
    mutant

Details for d1gsoa1

PDB Entry: 1gso (more details), 1.6 Å

PDB Description: glycinamide ribonucleotide synthetase (gar-syn) from e. coli.

SCOP Domain Sequences for d1gsoa1:

Sequence, based on SEQRES records: (download)

>d1gsoa1 b.84.2.1 (A:328-426) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Escherichia coli}
eraslgvvmaaggypgdyrtgdvihglpleevaggkvfhagtkladdeqvvtnggrvlcv
talghtvaeaqkrayalmtdihwddcfcrkdigwraier

Sequence, based on observed residues (ATOM records): (download)

>d1gsoa1 b.84.2.1 (A:328-426) Glycinamide ribonucleotide synthetase (GAR-syn), C-domain {Escherichia coli}
eraslgvvmaaggypgdyrtgdvihglpleevaggkvfhagtklaqvvtnggrvlcvtal
ghtvaeaqkrayalmtdihwddcfcrkdigwraier

SCOP Domain Coordinates for d1gsoa1:

Click to download the PDB-style file with coordinates for d1gsoa1.
(The format of our PDB-style files is described here.)

Timeline for d1gsoa1: