Class b: All beta proteins [48724] (180 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
Domain d1dv2b1: 1dv2 B:331-447 [28239] Other proteins in same PDB: d1dv2a2, d1dv2a3, d1dv2a4, d1dv2b2, d1dv2b3, d1dv2b4 complexed with atp; mutant |
PDB Entry: 1dv2 (more details), 2.5 Å
SCOPe Domain Sequences for d1dv2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dv2b1 b.84.2.1 (B:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq
Timeline for d1dv2b1:
View in 3D Domains from other chains: (mouse over for more information) d1dv2a1, d1dv2a2, d1dv2a3, d1dv2a4 |