SCOP 1.75: Domain d1dv2a1: 1dv2 A:331-447

Lineage for d1dv2a1 (1dv2 A:331-447)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (7 PDB entries)

8. Domain d1dv2a1: 1dv2 A:331-447 [28238]
   Other proteins in same PDB: d1dv2a2, d1dv2a3, d1dv2b2, d1dv2b3

Details for d1dv2a1

PDB Entry: 1dv2, 2.5 Å

PDB Description: the structure of biotin carboxylase, mutant e288k, complexed with atp

PDB Compounds: (A:) biotin carboxylase

SCOP Domain Sequences for d1dv2a1:

Sequence; same for both SEQRES and ATOM records:

>d1dv2a1 b.84.2.1 (A:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

Timeline for d1dv2a1:

• d1dv2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1dv2a1 appears in SCOP 1.73
  
• d1dv2a1 appears in SCOPe 2.01
  
• d1dv2a1 appears in the current release, SCOPe 2.08