Lineage for d1dv2a1 (1dv2 A:331-447)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234880Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 234924Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 234925Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 234926Protein Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), C-domain [51248] (1 species)
  7. 234927Species Escherichia coli [TaxId:562] [51249] (3 PDB entries)
  8. 234932Domain d1dv2a1: 1dv2 A:331-447 [28238]
    Other proteins in same PDB: d1dv2a2, d1dv2a3, d1dv2b2, d1dv2b3

Details for d1dv2a1

PDB Entry: 1dv2 (more details), 2.5 Å

PDB Description: the structure of biotin carboxylase, mutant e288k, complexed with atp

SCOP Domain Sequences for d1dv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv2a1 b.84.2.1 (A:331-447) Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), C-domain {Escherichia coli}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

SCOP Domain Coordinates for d1dv2a1:

Click to download the PDB-style file with coordinates for d1dv2a1.
(The format of our PDB-style files is described here.)

Timeline for d1dv2a1: