SCOPe 2.06: Domain d1bncb1: 1bnc B:331-448

Lineage for d1bncb1 (1bnc B:331-448)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)

8. Domain d1bncb1: 1bnc B:331-448 [28237]
   Other proteins in same PDB: d1bnca2, d1bnca3, d1bncb2, d1bncb3
   complexed with po4

Details for d1bncb1

PDB Entry: 1bnc, 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d1bncb1:

Sequence; same for both SEQRES and ATOM records:

>d1bncb1 b.84.2.1 (B:331-448) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqe

Timeline for d1bncb1:

• d1bncb1 first appeared (with stable ids) in SCOP 1.55
  
• d1bncb1 appears in SCOPe 2.05
  
• d1bncb1 appears in SCOPe 2.07
  
• d1bncb1 appears in the current release, SCOPe 2.08