Lineage for d1bncb1 (1bnc B:331-448)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 567972Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 568020Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 568021Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 568028Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 568031Species Escherichia coli [TaxId:562] [51249] (3 PDB entries)
  8. 568035Domain d1bncb1: 1bnc B:331-448 [28237]
    Other proteins in same PDB: d1bnca2, d1bnca3, d1bncb2, d1bncb3
    complexed with po4

Details for d1bncb1

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bncb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bncb1 b.84.2.1 (B:331-448) Biotin carboxylase (BC), C-domain {Escherichia coli}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqe

SCOP Domain Coordinates for d1bncb1:

Click to download the PDB-style file with coordinates for d1bncb1.
(The format of our PDB-style files is described here.)

Timeline for d1bncb1: