Lineage for d1bncb1 (1bnc B:331-448)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 115350Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 115393Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 115394Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 115395Protein Biotin carboxylase subunit of acetyl-CoA carboxylase, C-terminal domain [51248] (1 species)
  7. 115396Species Escherichia coli [TaxId:562] [51249] (3 PDB entries)
  8. 115400Domain d1bncb1: 1bnc B:331-448 [28237]
    Other proteins in same PDB: d1bnca2, d1bnca3, d1bncb2, d1bncb3

Details for d1bncb1

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bncb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bncb1 b.84.2.1 (B:331-448) Biotin carboxylase subunit of acetyl-CoA carboxylase, C-terminal domain {Escherichia coli}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqe

SCOP Domain Coordinates for d1bncb1:

Click to download the PDB-style file with coordinates for d1bncb1.
(The format of our PDB-style files is described here.)

Timeline for d1bncb1: