SCOP 1.63: Domain d1bnca1: 1bnc A:331-446

Lineage for d1bnca1 (1bnc A:331-446)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), C-domain [51248] (1 species)

7. Species Escherichia coli [TaxId:562] [51249] (3 PDB entries)

8. Domain d1bnca1: 1bnc A:331-446 [28236]
   Other proteins in same PDB: d1bnca2, d1bnca3, d1bncb2, d1bncb3

Details for d1bnca1

PDB Entry: 1bnc, 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bnca1:

Sequence; same for both SEQRES and ATOM records:

>d1bnca1 b.84.2.1 (A:331-446) Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), C-domain {Escherichia coli}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

Timeline for d1bnca1:

• d1bnca1 first appeared (with stable ids) in SCOP 1.55
  
• d1bnca1 appears in SCOP 1.61
  
• d1bnca1 appears in SCOP 1.65
  
• d1bnca1 appears in the current release, SCOPe 2.08