Class b: All beta proteins [48724] (119 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) |
Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins) probable rudiment form of the biotinyl-carrier domain |
Protein Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), C-domain [51248] (1 species) |
Species Escherichia coli [TaxId:562] [51249] (3 PDB entries) |
Domain d1bnca1: 1bnc A:331-446 [28236] Other proteins in same PDB: d1bnca2, d1bnca3, d1bncb2, d1bncb3 |
PDB Entry: 1bnc (more details), 2.4 Å
SCOP Domain Sequences for d1bnca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bnca1 b.84.2.1 (A:331-446) Biotin carboxylase subunit of acetyl-CoA carboxylase (BC), C-domain {Escherichia coli} rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl
Timeline for d1bnca1: