Lineage for d1bnca1 (1bnc A:331-446)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 172057Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies)
  4. 172100Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 172101Family b.84.2.1: BC C-terminal domain-like [51247] (4 proteins)
  6. 172102Protein Biotin carboxylase subunit of acetyl-CoA carboxylase, C-terminal domain [51248] (1 species)
  7. 172103Species Escherichia coli [TaxId:562] [51249] (3 PDB entries)
  8. 172106Domain d1bnca1: 1bnc A:331-446 [28236]
    Other proteins in same PDB: d1bnca2, d1bnca3, d1bncb2, d1bncb3

Details for d1bnca1

PDB Entry: 1bnc (more details), 2.4 Å

PDB Description: three-dimensional structure of the biotin carboxylase subunit of acetyl-coa carboxylase

SCOP Domain Sequences for d1bnca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnca1 b.84.2.1 (A:331-446) Biotin carboxylase subunit of acetyl-CoA carboxylase, C-terminal domain {Escherichia coli}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOP Domain Coordinates for d1bnca1:

Click to download the PDB-style file with coordinates for d1bnca1.
(The format of our PDB-style files is described here.)

Timeline for d1bnca1: