SCOPe 2.06: Domain d1dv1b1: 1dv1 B:331-448

Lineage for d1dv1b1 (1dv1 B:331-448)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)

5. Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
   probable rudiment form of the biotinyl-carrier domain

6. Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
   subunit of acetyl-CoA and pyruvate carboxylases

7. Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)

8. Domain d1dv1b1: 1dv1 B:331-448 [28235]
   Other proteins in same PDB: d1dv1a2, d1dv1a3, d1dv1b2, d1dv1b3
   complexed with po4

Details for d1dv1b1

PDB Entry: 1dv1, 1.9 Å

PDB Description: structure of biotin carboxylase (apo)

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d1dv1b1:

Sequence; same for both SEQRES and ATOM records:

>d1dv1b1 b.84.2.1 (B:331-448) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglqe

Timeline for d1dv1b1:

• d1dv1b1 first appeared (with stable ids) in SCOP 1.55
  
• d1dv1b1 appears in SCOPe 2.05
  
• d1dv1b1 appears in SCOPe 2.07
  
• d1dv1b1 appears in the current release, SCOPe 2.08