Lineage for d1dv1a1 (1dv1 A:331-446)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560231Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 1560238Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 1560241Species Escherichia coli [TaxId:562] [51249] (24 PDB entries)
  8. 1560257Domain d1dv1a1: 1dv1 A:331-446 [28234]
    Other proteins in same PDB: d1dv1a2, d1dv1a3, d1dv1b2, d1dv1b3
    complexed with po4

Details for d1dv1a1

PDB Entry: 1dv1 (more details), 1.9 Å

PDB Description: structure of biotin carboxylase (apo)
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d1dv1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dv1a1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl

SCOPe Domain Coordinates for d1dv1a1:

Click to download the PDB-style file with coordinates for d1dv1a1.
(The format of our PDB-style files is described here.)

Timeline for d1dv1a1: